CEND1 Antibody

Name CEND1 Antibody
Supplier Novus Biologicals
Catalog NBP1-70495
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CEND1(cell cycle exit and neuronal differentiation 1) The peptide sequence was selected from the N terminal of CEND1. Peptide sequence MESRGKSASSPKPDTKVPQVTTEAKVPPAADGKAPLTKPSKKEAPAEKQQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CEND1
Conjugate Unconjugated
Supplier Page Shop

Product images