WDR49 Antibody

Name WDR49 Antibody
Supplier Novus Biologicals
Catalog NBP1-70745
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to WDR49(WD repeat domain 49) The peptide sequence was selected from the C terminal of WDR49. Peptide sequence ACSFPKSQDFRCLFHFDEAHGRLFISFNNQLALLAMKSEASKRVKSHEKA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene WDR49
Conjugate Unconjugated
Supplier Page Shop

Product images