SR140 Antibody

Name SR140 Antibody
Supplier Novus Biologicals
Catalog NBP1-70713
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SR140(U2-associated SR140 protein) The peptide sequence was selected from the N terminal of SR140. Peptide sequence NLSRPLLENKLKAFSIGKMSTAKRTLSKKEQEELKKKEDEKAAAEIYEEF.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene U2SURP
Conjugate Unconjugated
Supplier Page Shop

Product images