ADPRM Antibody
| Name | ADPRM Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70766 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Pig |
| Antigen | Synthetic peptides corresponding to C17ORF48 The peptide sequence was selected from the middle region of C17orf48. Peptide sequence KYEQCMKILREHNPNTELNSPQGLSEPQFVQFNGGFSQEQLNWLNEVLTF. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ADPRM |
| Supplier Page | Shop |
Product images
![Western Blot: ADPRM Antibody [NBP1-70766] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/14032_ADPRM%2520Antibody-Western%2520Blot-NBP1-70766-img0002.jpg)
Western Blot: ADPRM Antibody [NBP1-70766] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.