TSGA13 Antibody

Name TSGA13 Antibody
Supplier Novus Biologicals
Catalog NBP1-70739
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TSGA13(testis specific, 13) The peptide sequence was selected from the middle region of TSGA13. Peptide sequence ASERPISKVIREPLTLASLLEDMPTRTAPGESAFRNGRAPQWIIKKATVI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TSGA13
Conjugate Unconjugated
Supplier Page Shop

Product images