KLHDC8B Antibody

Name KLHDC8B Antibody
Supplier Novus Biologicals
Catalog NBP1-70592
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to KLHDC8B(kelch domain containing 8B) The peptide sequence was selected from the middle region of KLHDC8B. Peptide sequence AMAEGSVFSLGGLQQPGPHNFYSRPHFVNTVEMFDLEHGSWTKLPRSLRM.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene KLHDC8B
Conjugate Unconjugated
Supplier Page Shop

Product images