COBLL1 Antibody

Name COBLL1 Antibody
Supplier Novus Biologicals
Catalog NBP1-70505
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to COBLL1(COBL-like 1) The peptide sequence was selected from the middle region of COBLL1. Peptide sequence QAKPSSFFLQMQKRVSGHYVTSAAAKSVHAAPNPAPKELTNKEAERDMLP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene COBLL1
Conjugate Unconjugated
Supplier Page Shop

Product images