Name | CLRN1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-70501 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to LOC646951(similar to hCG1786685) The peptide sequence was selected from the middle region of LOC646951. Peptide sequence SQETLHGVLTRSDVGYLQWGKDASEDDRLSQVGSMLKTPKLPIWLCNING. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | CLRN1 |
Conjugate | Unconjugated |
Supplier Page | Shop |