CLRN1 Antibody

Name CLRN1 Antibody
Supplier Novus Biologicals
Catalog NBP1-70501
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LOC646951(similar to hCG1786685) The peptide sequence was selected from the middle region of LOC646951. Peptide sequence SQETLHGVLTRSDVGYLQWGKDASEDDRLSQVGSMLKTPKLPIWLCNING.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CLRN1
Conjugate Unconjugated
Supplier Page Shop

Product images