CES7 Antibody
| Name | CES7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70499 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CES7(carboxylesterase 7) The peptide sequence was selected from the middle region of CES7. Peptide sequence LTEIRDSLLDLLGDVFFVVPALITARYHREGATEEEKLLSRKMMKYWATF. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CES5A |
| Supplier Page | Shop |
![Western Blot: CES7 Antibody [NBP1-70499] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/14045_CES7%2520Antibody-Western%2520Blot-NBP1-70499-img0003.jpg)
![Western Blot: CES7 Antibody [NBP1-70499] - HepG2 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/14046_CES7%2520Antibody-Western%2520Blot-NBP1-70499-img0002.jpg)