LRTOMT Antibody

Name LRTOMT Antibody
Supplier Novus Biologicals
Catalog NBP1-70628
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen Synthetic peptides corresponding to LRRC51(leucine rich repeat containing 51) The peptide sequence was selected from the N terminal of LRRC51. Peptide sequence MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSL.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene LRTOMT
Supplier Page Shop

Product images