Name | LRTOMT Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-70628 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse |
Antigen | Synthetic peptides corresponding to LRRC51(leucine rich repeat containing 51) The peptide sequence was selected from the N terminal of LRRC51. Peptide sequence MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSL. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | LRTOMT |
Supplier Page | Shop |