Name | LIPJ Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-70602 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Bovine, Horse |
Antigen | Synthetic peptides corresponding to LIPJ(lipase, family member J) The peptide sequence was selected from the C terminal of LIPJ. Peptide sequence LNLVHYNQTTSPLYNMTNMNVATAIWNGKSDLLADPEDVNILHSEITNHI. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | LIPJ |
Supplier Page | Shop |