LIPJ Antibody

Name LIPJ Antibody
Supplier Novus Biologicals
Catalog NBP1-70602
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Bovine, Horse
Antigen Synthetic peptides corresponding to LIPJ(lipase, family member J) The peptide sequence was selected from the C terminal of LIPJ. Peptide sequence LNLVHYNQTTSPLYNMTNMNVATAIWNGKSDLLADPEDVNILHSEITNHI.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene LIPJ
Supplier Page Shop

Product images