Tex14 Antibody

Name Tex14 Antibody
Supplier Novus Biologicals
Catalog NBP1-54999
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TEX14(testis expressed 14) The peptide sequence was selected from the C terminal of TEX14. Peptide sequence ASSDTLVAVEKSYSTSSPIEEDFEGIQGAFAQPQVSGEEKFQMRKILGKN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TEX14
Conjugate Unconjugated
Supplier Page Shop

Product images