ISYNA1 Antibody
| Name | ISYNA1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54984 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ISYNA1(myo-inositol 1-phosphate synthase A1) The peptide sequence was selected from the N terminal of ISYNA1. Peptide sequence LQEQLWPHMEALRPRPSVYIPEFIAANQSARADNLIPGSRAQQLEQIRRD. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ISYNA1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ISYNA1 Antibody [NBP1-54984] - Analysis of HepG2 cell lysate. Antibody Dilution: 1.0 ug/ml ISYNA1 is supported by BioGPS gene expression data to be expressed in HepG2.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24121_ISYNA1-Antibody-Western-Blot-NBP1-54984-img0004.jpg)
Western Blot: ISYNA1 Antibody [NBP1-54984] - Analysis of HepG2 cell lysate. Antibody Dilution: 1.0 ug/ml ISYNA1 is supported by BioGPS gene expression data to be expressed in HepG2.
![Western Blot: ISYNA1 Antibody [NBP1-54984] - Titration: 0.2-1 ug/ml Positive Control: Human Lung.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24122_ISYNA1-Antibody-Western-Blot-NBP1-54984-img0003.jpg)
Western Blot: ISYNA1 Antibody [NBP1-54984] - Titration: 0.2-1 ug/ml Positive Control: Human Lung.
![Western Blot: ISYNA1 Antibody [NBP1-54984] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24123_ISYNA1%2520Antibody-Western%2520Blot-NBP1-54984-img0005.jpg)
Western Blot: ISYNA1 Antibody [NBP1-54984] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.