RPS21 Antibody

Name RPS21 Antibody
Supplier Novus Biologicals
Catalog NBP1-54931
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RPS21 (ribosomal protein S21) The peptide sequence was selected from the middle region of RPS21. Peptide sequence NVAEVDKVTGRFNGQFKTYAICGAIRRMGESDDSILRLAKADGIVSKNF.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RPS21
Conjugate Unconjugated
Supplier Page Shop

Product images