INMT Antibody

Name INMT Antibody
Supplier Novus Biologicals
Catalog NBP1-55015
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to INMT(indolethylamine N-methyltransferase) The peptide sequence was selected from the N terminal of INMT (NP_006765). Peptide sequence KGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene INMT
Conjugate Unconjugated
Supplier Page Shop

Product images