AASD-PPT Antibody

Name AASD-PPT Antibody
Supplier Novus Biologicals
Catalog NBP1-54977
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to AASD-PPT. The peptide sequence was selected from the C terminal of AASDHPPT. Peptide sequence SRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPE
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene AASDHPPT
Conjugate Unconjugated
Supplier Page Shop

Product images