NGRN Antibody

Name NGRN Antibody
Supplier Novus Biologicals
Catalog NBP1-54971
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NGRN(neugrin, neurite outgrowth associated) The peptide sequence was selected from the N terminal of NGRN. Peptide sequence MAVTLSLLLGGRVCAAVTRCGFATRGVAGPGPIGREPDPDSDWEPEEREL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene NGRN
Conjugate Unconjugated
Supplier Page Shop

Product images