ARL13B Antibody

Name ARL13B Antibody
Supplier Novus Biologicals
Catalog NBP1-55498
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ARL13B (ADP-ribosylation factor-like 13B) The peptide sequence was selected from the middle region of ARL13B. Peptide sequence RVEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ARL13B
Conjugate Unconjugated
Supplier Page Shop

Product images