| Name | METTL13 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55484 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to KIAA0859(KIAA0859) The peptide sequence was selected from the C terminal of KIAA0859. Peptide sequence NEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTV. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | METTL13 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |