ACTRT1 Antibody

Name ACTRT1 Antibody
Supplier Novus Biologicals
Catalog NBP1-56370
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ACTRT1(actin-related protein T1) The peptide sequence was selected from the middle region of ACTRT1. Peptide sequence DTDIQNKLYADIVLSGGTTLLPGLEERLMKEVEQLASKGTPIKITASPDR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ACTRT1
Conjugate Unconjugated
Supplier Page Shop

Product images