C7orf31 Antibody

Name C7orf31 Antibody
Supplier Novus Biologicals
Catalog NBP1-56351
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C7ORF31 The peptide sequence was selected from the N terminal of C7ORF31. Peptide sequence EVIHGRPYCCRELEGADILSNTFYSNELHNPLQTVTRPTASEDRYQELRE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene C7orf31
Conjugate Unconjugated
Supplier Page Shop

Product images