CENPI Antibody
| Name | CENPI Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56364 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CENPI(centromere protein I) The peptide sequence was selected from the N terminal of CENPI. Peptide sequence SPQKRVKNVQAQNRTSQGSSSFQTTLSAWKVKQDPSNSKNISKHGQNNPV. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CENPI |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CENPI Antibody [NBP1-56364] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: MCF7 cell lysate CENPI is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7163_CENPI%2520Antibody-Western%2520Blot-NBP1-56364-img0002.jpg)
Western Blot: CENPI Antibody [NBP1-56364] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: MCF7 cell lysate CENPI is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells