OR2A5 Antibody

Name OR2A5 Antibody
Supplier Novus Biologicals
Catalog NBP1-68968
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to OR2A5 (olfactory receptor, family 2, subfamily A, member 5) The peptide sequence was selected from the C terminal of OR2A5. Peptide sequence ILAAILRIQSGEGRRKAFSTCSSHLCMVGLFFGSAIVMYMAPKSRHPEEQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene OR2A5
Conjugate Unconjugated
Supplier Page Shop

Product images