BBS10 Antibody

Name BBS10 Antibody
Supplier Novus Biologicals
Catalog NBP1-68993
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to BBS10 (Bardet-Biedl syndrome 10) The peptide sequence was selected from the C terminal of BBS10. Peptide sequence SQTGLESVMGKYQLLTSVLQCLTKILTIDMVITVKRHPQKVHNQDSEDEL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene BBS10
Conjugate Unconjugated
Supplier Page Shop

Product images