OR2W1 Antibody

Name OR2W1 Antibody
Supplier Novus Biologicals
Catalog NBP1-69041
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to OR2W1 (olfactory receptor, family 2, subfamily W, member 1) The peptide sequence was selected from the C terminal of OR2W1. Peptide sequence VVSMFYGTIIYMYLQPGNRASKDQGKFLTLFYTVITPSLNPLIYTLRNKD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene OR2W1
Conjugate Unconjugated
Supplier Page Shop

Product images