OR1J1 Antibody

Name OR1J1 Antibody
Supplier Novus Biologicals
Catalog NBP1-69092
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to OR1J1 (olfactory receptor, family 1, subfamily J, member 1) The peptide sequence was selected from the C terminal of OR1J1. Peptide sequence TKGICKALSTCGSHLSVVTIYYRTIIGLYFLPPSSNTNDKNIIASVIYTA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene OR1J1
Conjugate Unconjugated
Supplier Page Shop

Product images