REEP4 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-69521
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to REEP4(receptor accessory protein 4) The peptide sequence was selected from the N terminal of REEP4. Peptide sequence EIKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYE.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: REEP4
• Conjugate: Unconjugated