B3GALT1 Antibody
| Name | B3GALT1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69328 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to B3GALT1(UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 1) The peptide sequence was selected from the C terminal of B3GALT1. Peptide sequence YKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRY |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | B3GALT1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: B3GALT1 Antibody [NBP1-69328] - This Anti-B3GALT1 antibody was used in Western Blot of 721_B tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15265_B3GALT1-Antibody-Western-Blot-NBP1-69328-img0001.jpg)
Western Blot: B3GALT1 Antibody [NBP1-69328] - This Anti-B3GALT1 antibody was used in Western Blot of 721_B tissue lysate at a concentration of 1ug/ml.