B3GALT1 Antibody
| Name | B3GALT1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69327 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to B3GALT1(UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 1) The peptide sequence was selected from the N terminal of B3GALT1. Peptide sequence MASKVSCLYVLTVVCWASALWYLSITRPTSSYTGSKPFSHLTVARK |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | B3GALT1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: B3GALT1 Antibody [NBP1-69327] - This Anti-B3GALT1 antibody was used in Western Blot of Fetal Heart tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7040_B3GALT1-Antibody-Western-Blot-NBP1-69327-img0001.jpg)
![Western Blot: B3GALT1 Antibody [NBP1-69327] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7041_B3GALT1%2520Antibody-Western%2520Blot-NBP1-69327-img0002.jpg)