ST6GALNAC3 Antibody
| Name | ST6GALNAC3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69326 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ST6GALNAC3(ST6-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3) The peptide sequence was selected from the C terminal of ST6GALNAC3. Peptide sequence HYYEQGRDECDEYFLHEHAPYGGHRFITEKKVFAKWAKKHRIIFTHP |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ST6GALNAC3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ST6GALNAC3 Antibody [NBP1-69326] - This Anti-ST6GALNAC3 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15318_ST6GALNAC3%2520Antibody-Western%2520Blot-NBP1-69326-img0001.jpg)
Western Blot: ST6GALNAC3 Antibody [NBP1-69326] - This Anti-ST6GALNAC3 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.