SLC39A11 Antibody
| Name | SLC39A11 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69317 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | Synthetic peptides corresponding to SLC39A11(solute carrier family 39 (metal ion transporter), member 11) The peptide sequence was selected from the middle region of SLC39A11. Peptide sequence GGSSWRRIALLILAITIHNVPEGLAVGVGFGAIEKTASATFESARN |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SLC39A11 |
| Supplier Page | Shop |
Product images
![Western Blot: SLC39A11 Antibody [NBP1-69317] - This Anti-SLC39A11 antibody was used in Western Blot of 721_B tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/14107_SLC39A11%2520Antibody-Western%2520Blot-NBP1-69317-img0001.jpg)
Western Blot: SLC39A11 Antibody [NBP1-69317] - This Anti-SLC39A11 antibody was used in Western Blot of 721_B tissue lysate at a concentration of 1ug/ml.