ENT2 Antibody
| Name | ENT2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69312 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC29A2(solute carrier family 29 (nucleoside transporters), member 2) The peptide sequence was selected from the N terminal of SLC29A2. Peptide sequence ARILSTNHTGPEDAFNFNNWVTLLSQLPLLLFTLLNSFLYQCVPETVRIL |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | SLC29A2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: ENT2 Antibody [NBP1-69312] - This Anti-SLC29A2 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 2.5ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14419_ENT2-Antibody-Western-Blot-NBP1-69312-img0001.jpg)
![Immunohistochemistry: ENT2 Antibody [NBP1-69312] - Staining of human kidney section.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14420_ENT2-Antibody-Immunohistochemistry-NBP1-69312-img0002.jpg)