ADAM19 Antibody

Name ADAM19 Antibody
Supplier Novus Biologicals
Catalog NBP1-69367
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ADAM19(ADAM metallopeptidase domain 19 (meltrin beta)) The peptide sequence was selected from the N terminal of ADAM19. Peptide sequence GRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTRKLEDHCFYHGTVRET.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ADAM19
Conjugate Unconjugated
Supplier Page Shop

Product images