Name | ADAM19 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-69367 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to ADAM19(ADAM metallopeptidase domain 19 (meltrin beta)) The peptide sequence was selected from the N terminal of ADAM19. Peptide sequence GRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTRKLEDHCFYHGTVRET. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | ADAM19 |
Conjugate | Unconjugated |
Supplier Page | Shop |