HHAT Antibody
| Name | HHAT Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69465 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to HHAT(hedgehog acyltransferase) The peptide sequence was selected from the N terminal of human HHAT (NP_060664). Peptide sequence MLPRWELALYLLASLGFHFYSFYEVYKVSREHEEELDQEFELETDTLFGG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | HHAT |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: HHAT Antibody [NBP1-69465] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14682_HHAT-Antibody-Western-Blot-NBP1-69465-img0002.jpg)
Western Blot: HHAT Antibody [NBP1-69465] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
![Western Blot: HHAT Antibody [NBP1-69465] - This Anti-HHAT antibody was used in Western Blot of HT1080 tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14683_HHAT-Antibody-Western-Blot-NBP1-69465-img0001.jpg)
Western Blot: HHAT Antibody [NBP1-69465] - This Anti-HHAT antibody was used in Western Blot of HT1080 tissue lysate at a concentration of 1ug/ml.
![Western Blot: HHAT Antibody [NBP1-69465] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14684_HHAT%2520Antibody-Western%2520Blot-NBP1-69465-img0003.jpg)
Western Blot: HHAT Antibody [NBP1-69465] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.