B3GALT6 Antibody
| Name | B3GALT6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69396 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to B3GALT6(UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6) The peptide sequence was selected from the C terminal of B3GALT6. Peptide sequence VQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATLAREGRLCKRE |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | B3GALT6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: B3GALT6 Antibody [NBP1-69396] - This Anti-B3GALT6 antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16632_B3GALT6%2520Antibody-Western%2520Blot-NBP1-69396-img0001.jpg)
Western Blot: B3GALT6 Antibody [NBP1-69396] - This Anti-B3GALT6 antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.