C2orf29 Antibody

Name C2orf29 Antibody
Supplier Novus Biologicals
Catalog NBP1-56867
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C2ORF29 The peptide sequence was selected from the N terminal of C2ORF29. Peptide sequence NPFAASFAHLLNPAPPARGGQEPDRPPLSGFLPPITPPEKFFLSQLMLAP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CNOT11
Conjugate Unconjugated
Supplier Page Shop

Product images