Name | RAVER2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57133 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Bovine, Rabbit |
Antigen | Synthetic peptides corresponding to RAVER2(ribonucleoprotein, PTB-binding 2) The peptide sequence was selected from the middle region of RAVER2. Peptide sequence TITAGMGMLPFFPNQHIAGQAGPGHSNTQEKQPATVGMAEGNFSGSQPYL. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | RAVER2 |
Supplier Page | Shop |