RAVER2 Antibody

Name RAVER2 Antibody
Supplier Novus Biologicals
Catalog NBP1-57133
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Bovine, Rabbit
Antigen Synthetic peptides corresponding to RAVER2(ribonucleoprotein, PTB-binding 2) The peptide sequence was selected from the middle region of RAVER2. Peptide sequence TITAGMGMLPFFPNQHIAGQAGPGHSNTQEKQPATVGMAEGNFSGSQPYL.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene RAVER2
Supplier Page Shop

Product images