LSM8 Antibody

Name LSM8 Antibody
Supplier Novus Biologicals
Catalog NBP1-57082
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LSM8 (N(alpha)-acetyltransferase 38, NatC auxiliary subunit) The peptide sequence was selected from the N terminal of LSM8. Peptide sequence MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LSM8
Conjugate Unconjugated
Supplier Page Shop

Product images