SAAL1 Antibody

Name SAAL1 Antibody
Supplier Novus Biologicals
Catalog NBP1-57059
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SAAL1 (serum amyloid A-like 1) The peptide sequence was selected from the middle region of SAAL1. Peptide sequence EKLMLEWVRNGAAQPLDQPQEESEEQPVFRLVPCILEAAKQVRSENPEWL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SAAL1
Conjugate Unconjugated
Supplier Page Shop

Product images