C8orf45 Antibody

Name C8orf45 Antibody
Supplier Novus Biologicals
Catalog NBP1-57058
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Guinea Pig
Antigen Synthetic peptides corresponding to C8orf45 (chromosome 8 open reading frame 45) The peptide sequence was selected from the middle region of C8orf45. Peptide sequence IQAGSALLAKGGICFIGDLASHKKDKLEQLQTVLESRSITVYIPGKKFGE.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene MCMDC2
Supplier Page Shop

Product images