SKIV2L Antibody

Name SKIV2L Antibody
Supplier Novus Biologicals
Catalog NBP1-57119
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SKIV2L(superkiller viralicidic activity 2-like (S. cerevisiae)) The peptide sequence was selected from the middle region of SKIV2L. Peptide sequence SSNSTSRVFTTLVLCDKPLSQDPQDRGPATAEVPYPDDLVGFKLFLPEGP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SKIV2L
Conjugate Unconjugated
Supplier Page Shop

Product images