MPV17L2 Antibody
| Name | MPV17L2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57632 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to FKSG24(hypothetical protein MGC12972) The peptide sequence was selected from the N terminal of FKSG24. Peptide sequence PFLHYWYLSLDRLFPASGLRGFPNVLKKVLVDQLVASPLLGVWYFLGLGC. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | MPV17L2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MPV17L2 Antibody [NBP1-57632] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24819_MPV17L2-Antibody-Western-Blot-NBP1-57632-img0004.jpg)
Western Blot: MPV17L2 Antibody [NBP1-57632] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml
![Western Blot: MPV17L2 Antibody [NBP1-57632] - Human Muscle lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24820_MPV17L2-Antibody-Western-Blot-NBP1-57632-img0003.jpg)
Western Blot: MPV17L2 Antibody [NBP1-57632] - Human Muscle lysate, concentration 0.2-1 ug/ml.
![Western Blot: MPV17L2 Antibody [NBP1-57632] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: Human Muscle](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24821_MPV17L2%2520Antibody-Western%2520Blot-NBP1-57632-img0005.jpg)
Western Blot: MPV17L2 Antibody [NBP1-57632] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: Human Muscle