GSPT2 Antibody

Name GSPT2 Antibody
Supplier Novus Biologicals
Catalog NBP1-57646
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to GSPT2 (G1 to S phase transition 2) The peptide sequence was selected from the middle region of GSPT2)(50ug). Peptide sequence GANIKEQSDFCPWYTGLPFIPYLDNLPNFNRSIDGPIRLPIVDKYKDMGT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene GSPT2
Conjugate Unconjugated
Supplier Page Shop

Product images