MAGEA10 Antibody

Name MAGEA10 Antibody
Supplier Novus Biologicals
Catalog NBP1-57673
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MAGEA10(melanoma antigen family A, 10) The peptide sequence was selected from the middle region of MAGEA10. Peptide sequence NMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MAGEA10
Conjugate Unconjugated
Supplier Page Shop

Product images