C18orf25 Antibody

Name C18orf25 Antibody
Supplier Novus Biologicals
Catalog NBP1-57734
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C18orf25 (chromosome 18 open reading frame 25) The peptide sequence was selected from the N terminal of C18orf25)(50ug). Peptide sequence MKMEEAVGKVEELIESEAPPKASEQETAKEEDGSVELESQVQKDGVADST.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene C18orf25
Conjugate Unconjugated
Supplier Page Shop

Product images