Clusterin-like 1/CLUL1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57712
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to CLUL1 (clusterin-like 1 (retinal)) The peptide sequence was selected from the middle region of CLUL1)(50ug). Peptide sequence TEIIFNSIQVVPRIHEGNISKQDETMMTDLSILPSSNFTLKIPLEESAES.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: CLUL1
• Conjugate: Unconjugated