C20orf195 Antibody
| Name | C20orf195 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57700 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to C20ORF195 The peptide sequence was selected from the N terminal of C20ORF195. Peptide sequence RMKKVGTAQTKIQLLLLGDLLEQLDHGRAELDALLRSPDPRPFLADWALV. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | C20orf195 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: C20orf195 Antibody [NBP1-57700] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15604_C20orf195%2520Antibody-Western%2520Blot-NBP1-57700-img0002.jpg)
Western Blot: C20orf195 Antibody [NBP1-57700] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.