ANKRD7 Antibody

Name ANKRD7 Antibody
Supplier Novus Biologicals
Catalog NBP1-57699
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ANKRD7(ankyrin repeat domain 7) The peptide sequence was selected from the middle region of ANKRD7. Peptide sequence EYEADLEAKNKDGYTPLLVAVINNNPKMVKFLLEKGADVNASDNYQRTAL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ANKRD7
Conjugate Unconjugated
Supplier Page Shop

Product images