Hikeshi Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57764
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to C11orf73 (chromosome 11 open reading frame 73) The peptide sequence was selected from the middle region of C11orf73)(50ug). Peptide sequence DNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: C11orf73
• Conjugate: Unconjugated