CYB561 Antibody
| Name | CYB561 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69701 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | Synthetic peptides corresponding to CYB561(cytochrome b-561) The peptide sequence was selected from the middle region of CYB561. Peptide sequence LFPGASFSLRSRYRPQHIFFGATIFLLSVGTALLGLKEALLFNLGGKYSA. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CYB561 |
| Supplier Page | Shop |
Product images
![Western Blot: CYB561 Antibody [NBP1-69701] - This Anti-CYB561 antibody was used in Western Blot of Fetal Muscle tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/14160_CYB561%2520Antibody-Western%2520Blot-NBP1-69701-img0001.jpg)
Western Blot: CYB561 Antibody [NBP1-69701] - This Anti-CYB561 antibody was used in Western Blot of Fetal Muscle tissue lysate at a concentration of 1ug/ml.